PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C018728P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family bHLH
Protein Properties Length: 206aa    MW: 23325.5 Da    PI: 8.1855
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C018728P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH28.82.2e-092169655
                    HHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
             HLH  6 nerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55
                     ++E++RR+++++  ++L++l+P++   +   l   +    A++YIk+L+
  MELO3C018728P1 21 RIIEKNRRNQMKNLCDQLKSLVPQQ-YSKEVSLALPDQIDVAIKYIKDLE 69
                    68**********************7.13444466779**********995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088811.7571568IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474597.33E-111787IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000832.69E-51772No hitNo description
Gene3DG3DSA:4.10.280.101.6E-102088IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000104.5E-62169IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
MEYPNFQFSA SSSTAAKIER RIIEKNRRNQ MKNLCDQLKS LVPQQYSKEV SLALPDQIDV  60
AIKYIKDLEK KVNSAKEKKN RLQGKNKSAI NMDSSSSSSP QLKINQMGKS LEIVLSSGID  120
NQYLLCETLR ILQEEGIEVV NASFSVSGKS VFHTIHAELG DSMVEFGTTK ATERLKRLVY  180
GSNSDVELQK EKQWWEEFPS ENWDI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6817920.0LN681792.1 Cucumis melo genomic scaffold, anchoredscaffold00034.
GenBankLN7132550.0LN713255.1 Cucumis melo genomic chromosome, chr_1.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008455310.11e-150PREDICTED: transcription factor bHLH101-like
TrEMBLA0A0A0K2C91e-126A0A0A0K2C9_CUCSA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF9063498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G20970.15e-21bHLH family protein